PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_006280_gdiw.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 26102.9 Da    PI: 9.4697
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_006280_gdiw.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.51.5e-27959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+ien++nrqvt+skRrng++KKA+EL vLCda v++i++s+++k++ey+s
  Bv1_006280_gdiw.t1  9 KKIENQTNRQVTYSKRRNGLFKKANELTVLCDATVSIIMVSNSNKIHEYIS 59
                        68***********************************************86 PP

2K-box83.45e-2871169199
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yqk ++++++ ++++++qqel kL++ +++Lqr +R+++G++Le+L+l+eL  L q++++s++ iR++K++ l +qi++++kk ++ +e +
  Bv1_006280_gdiw.t1  71 YQKDKKVDVWMKQYQKMQQELMKLNETNRELQRDIRRRMGDCLEDLTLNELCCLGQEVNNSVTVIRERKMKKLDSQIDTTKKKLRNSSEVH 161
                         78889999*********************************************************************************** PP

               K-box  92 kaLrkkle 99 
                         k+L ++++
  Bv1_006280_gdiw.t1 162 KNLLSQFD 169
                         ***99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.4E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.501161IPR002100Transcription factor, MADS-box
CDDcd002657.84E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-26323IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-34394IPR002100Transcription factor, MADS-box
PfamPF003191.6E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.4E-263859IPR002100Transcription factor, MADS-box
PfamPF014866.7E-1782168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.50384174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MARGKIQIKK IENQTNRQVT YSKRRNGLFK KANELTVLCD ATVSIIMVSN SNKIHEYISP  60
GNTTKEIYDR YQKDKKVDVW MKQYQKMQQE LMKLNETNRE LQRDIRRRMG DCLEDLTLNE  120
LCCLGQEVNN SVTVIRERKM KKLDSQIDTT KKKLRNSSEV HKNLLSQFDL PKEEPQYGLV  180
DNGEYNHVLG YNDDSRILAL RLQPCQPLLH GSAGSGSCLT TYTLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-14159159Myocyte-specific enhancer factor 2B
1tqe_R3e-14159159Myocyte-specific enhancer factor 2B
1tqe_Q3e-14159159Myocyte-specific enhancer factor 2B
1tqe_P3e-14159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0766023e-36KM076602.1 Chenopodium album clone 1 APETALA3 (AP3) gene, partial cds.
GenBankKM0766033e-36KM076603.1 Chenopodium album clone 2 APETALA3 (AP3) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672335.11e-167PREDICTED: floral homeotic protein DEFICIENS-like isoform X1
SwissprotP237062e-93DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A0J8FYD31e-167A0A0J8FYD3_BETVU; Uncharacterized protein
STRINGGLYMA04G02980.11e-85(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.14e-84MIKC_MADS family protein